PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07374
Common NameKK1_007577
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 272aa    MW: 30934.8 Da    PI: 8.8132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07374genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.8e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd +l +++ ++G g+W++++ + g+ R +k+c++rw +yl
    C.cajan_07374 15 KGLWSPEEDNKLRNYILKHGHGCWSSVPIKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding569e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E+e ++ ++++lG++ W+ I+++++ gRt++++k++w++yl
    C.cajan_07374  68 RGKFSKQEEETILALHHMLGNK-WSQISQHLP-GRTDNEIKNYWHSYL 113
                      89********************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-22965IPR009057Homeodomain-like
PROSITE profilePS5129418.4141062IPR017930Myb domain
SuperFamilySSF466896.6E-2912109IPR009057Homeodomain-like
SMARTSM007171.1E-111464IPR001005SANT/Myb domain
PfamPF002495.3E-141562IPR001005SANT/Myb domain
CDDcd001678.65E-101862No hitNo description
PROSITE profilePS5129426.09463117IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-2666117IPR009057Homeodomain-like
SMARTSM007171.6E-1667115IPR001005SANT/Myb domain
PfamPF002491.2E-1668113IPR001005SANT/Myb domain
CDDcd001673.98E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGCQPLEKAK PKHKKGLWSP EEDNKLRNYI LKHGHGCWSS VPIKAGLQRN GKSCRLRWIN  60
YLRPGLKRGK FSKQEEETIL ALHHMLGNKW SQISQHLPGR TDNEIKNYWH SYLKKRMAKS  120
KEMEYENQMK YGSSSSDTMD SSHSFQKLAT QGPQNYGFNK EACQSSLPKL LFAEWLSLDH  180
VNGGNTNSVD SLGLRNGFDQ NSTFQEASIH DMSEVPFGGE YHRCVTNISA SEMFNSQLKY  240
ANQTVENGFL HCVTGVDLCS NFSVSNDAIM YV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-22111173108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0977340.0BT097734.1 Soybean clone JCVI-FLGm-16G14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007143397.11e-169hypothetical protein PHAVU_007G069200g
SwissprotQ9M0K43e-64LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A151U6H00.0A0A151U6H0_CAJCA; Transcription factor LAF1
STRINGGLYMA20G29710.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.19e-62myb domain protein 45